Skip to main content

Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35902

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-35902-100ul
NBP3-35902-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-386 of human Protein Kinase A regulatory subunit I alpha (NP_002725.1).

Sequence:
AAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Protein Kinase A regulatory subunit I alpha Antibody - BSA Free (NBP3-35902) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Protein Kinase A regulatory subunit I alpha Antibody

Western Blot: Protein Kinase A regulatory subunit I alpha Antibody [NBP3-35902] -

Western Blot: Protein Kinase A regulatory subunit I alpha Antibody [NBP3-35902] - Western Blot analysis of lysates from Mouse testis using Protein Kinase A regulatory subunit I alpha Rabbit pAbat 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Protein Kinase A regulatory subunit I alpha Antibody

Immunocytochemistry/ Immunofluorescence: Protein Kinase A regulatory subunit I alpha Antibody [NBP3-35902] -

Immunocytochemistry/ Immunofluorescence: Protein Kinase A regulatory subunit I alpha Antibody [NBP3-35902] - Immunofluorescence analysis of NIH/3T3 cells using Protein Kinase A regulatory subunit I alpha Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Protein Kinase A regulatory subunit I alpha Antibody

Immunocytochemistry/ Immunofluorescence: Protein Kinase A regulatory subunit I alpha Antibody [NBP3-35902] -

Immunocytochemistry/ Immunofluorescence: Protein Kinase A regulatory subunit I alpha Antibody [NBP3-35902] - Immunofluorescence analysis of NIH/3T3 cells using Protein Kinase A regulatory subunit I alpha Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Protein Kinase A regulatory subunit I alpha

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Three alternatively spliced transcript variants encoding the same protein have been observed.

Long Name

cAMP-dependent protein kinase type I-alpha regulatory subunit

Alternate Names

PRKAR1, PRKAR1A, TSE1

Gene Symbol

PRKAR1A

Additional Protein Kinase A regulatory subunit I alpha Products

Product Documents for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...