Skip to main content

POR/Cytochrome P450 Reductase Antibody (9U1U7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16534

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16534-100ul
NBP3-16534-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9U1U7 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human POR/Cytochrome P450 Reductase (P16435). KDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit POR/Cytochrome P450 Reductase Antibody (9U1U7) (NBP3-16534) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for POR/Cytochrome P450 Reductase Antibody (9U1U7)

Western Blot: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534]

Western Blot: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534]

Western Blot: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Western blot analysis of extracts of various cell lines, using POR/Cytochrome P450 Reductase Rabbit mAb (NBP3-16534) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 10s.
POR/Cytochrome P450 Reductase Antibody (9U1U7)

Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] -

Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Analysis of CYPOR in paraffin-embedded mouse intestin tissue using CYPOR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
POR/Cytochrome P450 Reductase Antibody (9U1U7)

Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] -

Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (9U1U7) [NBP3-16534] - Analysis of CYPOR in paraffin-embedded mouse kidney tissue using CYPOR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for POR/Cytochrome P450 Reductase Antibody (9U1U7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: POR/Cytochrome P450 Reductase

NADPH-Cytochrome P450 Reductase (P450R) is an essential component of the cytochrome P450 monooxygenase system of eukaryotic cells. P450R is anchored in the endoplasmic reticulum membrane with its catalytic domain residing in the cytosol. P450R is a flavoprotein, containing one molecule each of FMN and FAD, which are essential for the transfer of electrons from NADPH to the cytochromes P450. This reduction is necessary for cytochromes P450 to perform each cycle of oxidation. P450R is also capable of transferring electrons to cytochrome b5, heme oxygenase, the fatty acid elongation system, and other proteins. Mutations of P450R can result in disordered steroidogenesis and Antley-Bixler syndrome.

Long Name

NADPH Cytochrome P450 Reductase

Alternate Names

CPR, CYPOR, Cytochrome P450 Reductase, P450R

Gene Symbol

POR

Additional POR/Cytochrome P450 Reductase Products

Product Documents for POR/Cytochrome P450 Reductase Antibody (9U1U7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for POR/Cytochrome P450 Reductase Antibody (9U1U7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...