PCK2 Antibody (10L10J8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16418

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16418-100ul
NBP3-16418-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10L10J8 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all PCK2 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PCK2 (Q16822). ENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PCK2 Antibody (10L10J8) (NBP3-16418) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PCK2 Antibody (10L10J8)

Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418]

Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418]

Western Blot: PCK2 Antibody (10L10J8) [NBP3-16418] - Western blot analysis of extracts of various cell lines, using PEPCK/PCK2 Rabbit mAb (NBP3-16418) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418]

Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418]

Immunocytochemistry/Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] - Immunofluorescence analysis of HeLa cells using PEPCK/PCK2 Rabbit mAb (NBP3-16418) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
PCK2 Antibody (10L10J8)

Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] -

Immunocytochemistry/ Immunofluorescence: PCK2 Antibody (10L10J8) [NBP3-16418] - Confocal imaging of C2C12 cells using [KO Validated] PCK2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
View 2 more images

Applications for PCK2 Antibody (10L10J8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PCK2

PCK2 encodes a member of the phosphoenolpyruvate carboxykinase (GTP) family. The protein is a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of GTP. A cytosolic form encoded by a different gene has also been characterized and is the key enzyme of gluconeogenesis in the liver. The encoded protein may serve a similar function, although it is constitutively expressed and not modulated by hormones such as glucagon and insulin that regulate the cytosolic form. Alternatively spliced transcript variants have been described.

Alternate Names

EC 4.1.1.32, PE, PEPCK, PEPCK2PEP carboxykinase, PEPCK-M, phosphoenolpyruvate carboxykinase [GTP], mitochondrial, phosphoenolpyruvate carboxykinase 2 (mitochondrial), Phosphoenolpyruvate carboxylase, phosphopyruvate carboxylase

Gene Symbol

PCK2

Additional PCK2 Products

Product Documents for PCK2 Antibody (10L10J8)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PCK2 Antibody (10L10J8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.