Skip to main content

PATZ Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48884

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48884

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PATZ Antibody - BSA Free (NBP2-48884) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PATZ Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PATZ Antibody [NBP2-48884]

Immunocytochemistry/ Immunofluorescence: PATZ Antibody [NBP2-48884]

Immunocytochemistry/Immunofluorescence: PATZ Antibody [NBP2-48884] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry: PATZ Antibody [NBP2-48884]

Immunohistochemistry: PATZ Antibody [NBP2-48884]

Immunohistochemistry: PATZ Antibody [NBP2-48884] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules.
PATZ Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: PATZ Antibody - BSA Free [NBP2-48884]

Chromatin Immunoprecipitation-exo-Seq: PATZ Antibody - BSA Free [NBP2-48884]

ChIP-Exo-Seq composite graph for Anti-PATZ1 (NBP2-48884) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for PATZ Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PATZ

PATZ is encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra-chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene. [provided by RefSeq]

Alternate Names

dJ400N23, MAZRPOZ-, AT hook-, and zinc finger-containing protein 1, PATZZinc finger and BTB domain-containing protein 19, POZ (BTB) and AT hook containing zinc finger 1, Protein kinase A RI subunit alpha-associated protein, RIAZBTB/POZ domain zinc finger transcription factor, ZBTB19BTB-POZ domain zinc finger transcription factor, Zinc finger protein 278Zinc finger sarcoma gene protein, ZNF278POZ-AT hook-zinc finger protein, ZSGMAZ-related factor

Gene Symbol

PATZ1

Additional PATZ Products

Product Documents for PATZ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PATZ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...