Skip to main content

NDUFAB1 Antibody [Alexa Fluor® 488]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35453AF488

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-35453AF488 has been discontinued. View all NDUFAB1 products.

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Alexa Fluor 488 (Excitation = 488 nm, Emission = 515-545 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-156 of human NDUFAB1 (NP_004994.1).

Sequence:
PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for NDUFAB1 Antibody [Alexa Fluor® 488]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: NDUFAB1

Carrier of the growing fatty acid chain in fatty acid biosynthesis in mitochondria. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain

Alternate Names

ACPMGC65095, acyl carrier protein, mitochondrial, CI-SDAP, complex I SDAP subunit, FASN2A, mitochondrial acyl carrier protein, NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (8kD, SDAP), NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa, NADH:ubiquinone oxidoreductase SDAP subunit, NADH-ubiquinone oxidoreductase 9.6 kDa subunit, SDAP

Gene Symbol

NDUFAB1

Additional NDUFAB1 Products

Product Documents for NDUFAB1 Antibody [Alexa Fluor® 488]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NDUFAB1 Antibody [Alexa Fluor® 488]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...