Skip to main content

Myosin Light Chain 2 Antibody (5M6Q8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16693

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16693-100ul
NBP3-16693-20ul

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5M6Q8 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 67-166 of human Myosin Light Chain 2 (P10916). DEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Myosin Light Chain 2 Antibody (5M6Q8) (NBP3-16693) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Myosin Light Chain 2 Antibody (5M6Q8)

Western Blot: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693]

Western Blot: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693]

Western Blot: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693] - Western blot analysis of extracts of various cell lines, using Myosin Light Chain 2 Rabbit mAb (NBP3-16693) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693]

Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693]

Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693] - Immunofluorescence analysis of mouse heart using Myosin Light Chain 2 Rabbit mAb (NBP3-16693) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693]

Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693]

Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693] - Immunofluorescence analysis of rat heart using Myosin Light Chain 2 Rabbit mAb (NBP3-16693) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Myosin Light Chain 2 Antibody (5M6Q8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Myosin Light Chain 2

MYL2 (myosin, light chain 2, regulatory, cardiac, slow), also known as MLC-2, MLC2v. Entrez protein NP_000423. MYL2 associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. It is an hexamer of two heavy chains and four light chains that is predominantly expressed in adult cardiac ventricle muscle. Mutations in MYL2 are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

Alternate Names

cardiac ventricular myosin light chain 2, CMH10myosin light chain 2, DKFZp779C0562, MLC2, MLC-2, MLC-2v, myosin regulatory light chain 2, ventricular/cardiac muscle isoform, myosin, light chain 2, regulatory, cardiac, slow, myosin, light polypeptide 2, regulatory, cardiac, slow, regulatory light chain of myosin, RLC of myosin, slow cardiac myosin regulatory light chain 2

Gene Symbol

MYL2

Additional Myosin Light Chain 2 Products

Product Documents for Myosin Light Chain 2 Antibody (5M6Q8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Myosin Light Chain 2 Antibody (5M6Q8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...