Skip to main content

MBP Antibody (7D2) - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-05204

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat, Porcine, Bovine, Equine

Cited:

Rat

Applications

Validated:

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # 7D2

Format

BSA Free

Concentration

1 mg/ml

Product Specifications

Immunogen

Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.

Specificity

The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP.

Marker

Oligodendrocyte Marker, Myelin Marker

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Theoretical MW

18.5/21.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Mouse MBP Antibody (7D2) - BSA Free (NBP1-05204) is a monoclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MBP Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for MBP Antibody (7D2) - BSA Free

Western Blot: MBP Antibody (7D2) [NBP1-05204]

Western Blot: MBP Antibody (7D2) [NBP1-05204]

Western Blot: MBP Antibody (7D2) [NBP1-05204] - Analysis of different tissue lysates using mouse mAb to MBP, NBP1-05204, dilution 1:10,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] cow spinal cord. Bands at 21.5kDa and 18.5kDa are the two larger transcripts from the MBP gene, showing that the epitope of this antibody depends on the sequence encoded by exon 2. Note that monoclonal NBP1-05203 binds all four rat MBP transcripts running at 21.5kDa, 18.5kDa, 17kDa and 14kDa, so that this antibody binds to the core sequence of human and rodent MBP.
Immunohistochemistry: MBP Antibody (7D2) [NBP1-05204]

Immunohistochemistry: MBP Antibody (7D2) [NBP1-05204]

Immunohistochemistry: MBP Antibody (7D2) [NBP1-05204] - Analysis rat brain hippocampal section stained with mouse mAb to myelin basic protein (MBP), NBP1-05204, dilution 1:5,000 in green, and costained with rabbit pAb to NF-M, RPCA-NF-M, dilution 1:2,000, in red. The MBP antibody stains myelin sheathes around axons, while the NF-M antibody labels dendrites and axons of neuronal cells.

Applications for MBP Antibody (7D2) - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:2000-5000

Immunohistochemistry

1:10000

Western Blot

1:5000-1:10000
Application Notes
This Myelin Basic Protein (7D2) antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot, where a band can be seen at ~21.5 kDa.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50% PBS, 50% glycerol

Format

BSA Free

Preservative

5mM Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MBP

Myelin Basic protein (MBP), along with myelin proteolipid protein (PLP/lipophilin), is the most abundant protein constituents of myelin membrane in the CNS cells. MBP plays a key role in both the formation as well as the stabilization of this compact multilayer arrangement of bilayers. MBP is a homodimer that can self-associates in the presence of lysolipid, and is localized in myelin membrane as peripheral membrane protein on the cytoplasmic side of myelin. MBP is found in CNS/PNS and after post-translational modifications (PTMs), at least 6 charge isomers are produced: C1 (most cationic/least modified form), C2, C3, C4, C5 and C6 (the least cationic form); and its potential PTMs includes - phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues. MBP phosphorylations are executed by TAOK2, VRK2, MAPK11, MAPK12, MAPK14 and MINK1. Citrullination and methylation modifications of MBP may lead to reduction in surface charge that follows its weakened attachment with myelin membranes and this mechanism has been proposed to be operative in demyelinating diseases such as chronical multiple sclerosis (MS), fulminating MS (Marburg disease) etc.

Long Name

Myelin Basic Protein

Alternate Names

Hmbpr, mld, shi

Entrez Gene IDs

24547 (Rat)

Gene Symbol

MBP

Additional MBP Products

Product Documents for MBP Antibody (7D2) - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MBP Antibody (7D2) - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...