Skip to main content

Maxi Potassium channel alpha Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87782

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-87782

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Maxi Potassium channel alpha. Peptide sequence: ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit Maxi Potassium channel alpha Antibody - BSA Free (NBP2-87782) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Maxi Potassium channel alpha Antibody - BSA Free

Western Blot: Maxi Potassium channel alpha Antibody [NBP2-87782]

Western Blot: Maxi Potassium channel alpha Antibody [NBP2-87782]

Western Blot: Maxi Potassium channel alpha Antibody [NBP2-87782] - WB Suggested Anti-KCNMA1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Hela cell lysate

Applications for Maxi Potassium channel alpha Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Maxi Potassium channel alpha/KCNMA1

Function: Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX). The protein was initially thought to contain two functionally distinct parts: The core channel (from the N-terminus to the S9 segment) that mediates the channel activity, and the cytoplasmic tail (from the S9 segment to the C-terminus) that mediates the calcium sensing. The situation is however more complex, since the core channel also contains binding sites for Ca(2+) and Mg(2+).; Defects in KCNMA1 are the cause of generalized epilepsy and paroxysmal dyskinesia (GEPD). Epilepsy is one of the most common and debilitating neurological disorders. Paroxysmal dyskinesias are neurological disorders characterized by sudden, unpredictable, disabling attacks of involuntary movement often requiring life-long treatment. The coexistence of epilepsy and paroxysmal dyskinesia in the same individual or family is an increasingly recognized phenomenon. Patients manifest absence seizures, generalized tonic-clonic seizures, paroxysmal nonkinesigenic dyskinesia, involuntary dystonic or choreiform movements. Onset is usually in childhood and patients may have seizures only, dyskinesia only, or both.; Enzyme regulation: Ethanol and carbon monoxide-bound heme increase channel activation. Heme inhibits channel activation.; Subcellular location: Membrane, Multi-pass membrane protein.; Tissue specificity: Widely expressed. Except in myocytes, it is almost ubiquitously expressed.

Long Name

Calcium-activated potassium channel subunit alpha-1

Alternate Names

BK channel, BKCA alpha, hSlo, K(VCA)alpha, KCa1.1, KCNMA, KCNMA1, Maxi K channel, MaxiK, SLO, Slo homolog, Slo-alpha, Slo1, Slowpoke homolog

Gene Symbol

KCNMA1

Additional Maxi Potassium channel alpha/KCNMA1 Products

Product Documents for Maxi Potassium channel alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Maxi Potassium channel alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...