Skip to main content

Laminin beta 3 Antibody [Alexa Fluor® 405]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35175AF405

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-35175AF405 has been discontinued. View all Laminin beta 3 products.

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Alexa Fluor 405 (Excitation = 405 nm, Emission = 421 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 762-1004 of human Laminin beta 3 (NP_000219.2).

Sequence:
QQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQYGEWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVMMEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRPNARLNGGKVQLNLMDLVSGIPATQSQKIQEVGEITNLRVNFTRLAPVPQR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for Laminin beta 3 Antibody [Alexa Fluor® 405]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Laminin beta 3

The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene.

Alternate Names

BM600-125kDa, Epiligrin subunit bata, FLJ99565, Kalinin B1 chain, Kalinin subunit beta, kalinin-140kDa, LAM5, Laminin 5, Laminin B1k chain, laminin S B3 chain, laminin subunit beta-3, laminin, beta 3, laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD)), Laminin-5 subunit beta, LAMNB1, Nicein subunit beta, nicein-125kDa

Gene Symbol

LAMB3

Additional Laminin beta 3 Products

Product Documents for Laminin beta 3 Antibody [Alexa Fluor® 405]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Laminin beta 3 Antibody [Alexa Fluor® 405]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...