Kv1.1 Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03729
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 426-495 of human Kv1.1 (NP_000208.2). QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit Kv1.1 Antibody - Azide and BSA Free (NBP3-03729) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Kv1.1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] -
Immunocytochemistry/ Immunofluorescence: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] - Immunofluorescence analysis of paraffin-embedded mouse brain using Kv1.1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Western Blot: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] -
Western Blot: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] - Western blot analysis of lysates from HeLa cells, using Kv1.1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit .
Exposure time: 30s.
Western Blot: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] -
Western Blot: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] - Western blot analysis of various lysates, using Kv1.1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit .
Exposure time: 60s.
Applications for Kv1.1 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Kv1.1
Long Name
Potassium voltage-gated channel subfamily A member 1
Alternate Names
KCNA1
Gene Symbol
KCNA1
Additional Kv1.1 Products
Product Documents for Kv1.1 Antibody - Azide and BSA Free
Product Specific Notices for Kv1.1 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov