Skip to main content

Kv1.1 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03729

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-03729-100ul
NBP3-03729-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 426-495 of human Kv1.1 (NP_000208.2). QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Kv1.1 Antibody - Azide and BSA Free (NBP3-03729) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Kv1.1 Antibody - Azide and BSA Free

Kv1.1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] -

Immunocytochemistry/ Immunofluorescence: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] - Immunofluorescence analysis of paraffin-embedded mouse brain using Kv1.1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Kv1.1 Antibody - Azide and BSA Free

Western Blot: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] -

Western Blot: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] - Western blot analysis of lysates from HeLa cells, using Kv1.1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit .
Exposure time: 30s.
Kv1.1 Antibody - Azide and BSA Free

Western Blot: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] -

Western Blot: Kv1.1 Antibody - Azide and BSA Free [Kv1.1] - Western blot analysis of various lysates, using Kv1.1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit .
Exposure time: 60s.

Applications for Kv1.1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Kv1.1

Kv1.1 belongs to a (Shaker) subfamily of the pota ium channel family. It is a major constituent of presynaptic A-type channels that modulate synaptic transmi ion in CNS neurons. Kv1.1-containing channels have been shown to be complexed with Lgi1, which is causative for an autosomal dominant form of lateral temporal lobe epilepsy. In the hippocampus Kv1.1 and Lgi1 are coa embled with Kv1.4 and Kv 1 in axonal terminals. Kv1.1 is an abundant Kv subunit in the brain that is found predominantly localized to axons and nerve terminals. Mutations in human Kv1.1 result in the dominant disorder Episodic Ataxia Type 1.

Long Name

Potassium voltage-gated channel subfamily A member 1

Alternate Names

KCNA1

Gene Symbol

KCNA1

Additional Kv1.1 Products

Product Documents for Kv1.1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Kv1.1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov