Skip to main content

KCNJ1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87660

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-87660

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNJ1. Peptide sequence: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit KCNJ1 Antibody - BSA Free (NBP2-87660) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for KCNJ1 Antibody - BSA Free

Western Blot: KCNJ1 Antibody [NBP2-87660]

Western Blot: KCNJ1 Antibody [NBP2-87660]

Western Blot: KCNJ1 Antibody [NBP2-87660] - Lanes: Lane 1: 30ug mouse renal epithelial lysate. Lane 2: 30ug mouse renal epithelial lysate. Lane 3: 30ug mouse renal epithelial lysate. Primary Antibody Dilution: 1:500. Secondary Antibody: Anti-rabbit-HRP. Secondary Antibody Dilution: 1:2500. Gene Name: KCNJ1. Submitted by: Dr. JUNMING FAN,ECU.
Western Blot: KCNJ1 Antibody [NBP2-87660]

Western Blot: KCNJ1 Antibody [NBP2-87660]

Western Blot: KCNJ1 Antibody [NBP2-87660] - WB Suggested Anti-KCNJ1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

Applications for KCNJ1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNJ1

FUNCTION: In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.; Tissue specificity: In the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver.; Subcellular location: Membrane, Multi-pass membrane protein.; Involvement in disease: Defects in KCNJ1 are the cause of Bartter syndrome type 2 (BS2) also termed hyperprostanglandin E syndrome 2. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS2 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS2 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.

Alternate Names

ATP-regulated potassium channel ROM-K, ATP-sensitive inward rectifier potassium channel 1, inwardly rectifying K+ channel, Kir1.1, potassium inwardly-rectifying channel, subfamily J, member 1, ROMK1inwardly rectifying subfamily J member 1

Gene Symbol

KCNJ1

Additional KCNJ1 Products

Product Documents for KCNJ1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KCNJ1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...