Skip to main content

Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-97732CL1

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

CoraFluor 1

Antibody Source

Monoclonal Mouse IgG1 Clone # 54B3

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.

Reactivity Notes

A broad species reactivity is expected because of the conserved nature of the epitope.

Specificity

This antibody recognizes specifically the cytoplasmic domain of integrin subunit Integrin alpha 3B which is present in microvascular structures in brain and heart.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Description

CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.

CoraFluor(TM) 1, amine reactive

CoraFluor(TM) 1, thiol reactive

For more information, please see our CoraFluor(TM) TR-FRET technology flyer.

Scientific Data Images for Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

Product Feature: CoraFluor Probes for TR-FRET

CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser.

Applications for Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Frozen

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined..

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

PBS

Preservative

No Preservative

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark. Do not freeze.

Background: Integrin alpha 3B

Alternate Names

AA407068, CD49C, GAPB3, integrin alpha 3

Gene Symbol

ITGA3

Additional Integrin alpha 3B Products

Product Documents for Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...