Skip to main content

Integrin alpha 3/CD49c Antibody (29A3) [CoraFluor™ 1]

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-97692CL1

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Porcine

Applications

Immunohistochemistry, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

CoraFluor 1

Antibody Source

Monoclonal Mouse IgG1 Clone # 29A3

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the Integrin alpha 3/CD49c including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Reactivity Notes

A broad species reactivity is expected based on the conserved nature of the epitope. Use in Porcine reported in scientific literature (PMID:32211117).

Specificity

This antibody recognizes specifically the cytoplasmic domain of Integrin alpha 3/CD49c which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Description

CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.

CoraFluor(TM) 1, amine reactive

CoraFluor(TM) 1, thiol reactive

For more information, please see our CoraFluor(TM) TR-FRET technology flyer.

Scientific Data Images for Integrin alpha 3/CD49c Antibody (29A3) [CoraFluor™ 1]

Integrin alpha 3/CD49c Antibody (29A3) [CoraFluor™ 1]

Product Feature: CoraFluor Probes for TR-FRET

CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser.

Applications for Integrin alpha 3/CD49c Antibody (29A3) [CoraFluor™ 1]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Frozen

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined..

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

PBS

Preservative

No Preservative

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark. Do not freeze.

Background: Integrin alpha 3/CD49c

Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 (VLA3), very common antigen 2 (VCA2), extracellular matrix receptor 1 (ECMR1), and galactoprotein b3 (GAPB3).

Alternate Names

CD49c, ITGA3

Gene Symbol

ITGA3

Additional Integrin alpha 3/CD49c Products

Product Documents for Integrin alpha 3/CD49c Antibody (29A3) [CoraFluor™ 1]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Integrin alpha 3/CD49c Antibody (29A3) [CoraFluor™ 1]

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...