Integrin alpha 3/CD49c Antibody (158A3) [CoraFluor™ 1]
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-97691CL1
Conjugate
Catalog #
Forumulation
Catalog #
Key Product Details
Species Reactivity
Human, Canine
Applications
Immunohistochemistry, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
CoraFluor 1
Antibody Source
Monoclonal Mouse IgG2A Clone # 158A3
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the Integrin alpha 3/CD49c including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Reactivity Notes
A broad species reactivity is expected based on the conserved nature of the epitope.
Specificity
This antibody reacts exclusively with the cytoplasmic domain of non-phosphorylated Integrin alpha 3/CD49c.
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2A
Description
CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
CoraFluor(TM) 1, amine reactive
CoraFluor(TM) 1, thiol reactive
For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
CoraFluor(TM) 1, amine reactive
CoraFluor(TM) 1, thiol reactive
For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
Scientific Data Images for Integrin alpha 3/CD49c Antibody (158A3) [CoraFluor™ 1]
Product Feature: CoraFluor Probes for TR-FRET
CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser.Applications for Integrin alpha 3/CD49c Antibody (158A3) [CoraFluor™ 1]
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Frozen
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined..
Formulation, Preparation, and Storage
Purification
Protein A or G purified
Formulation
PBS
Preservative
No Preservative
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C in the dark. Do not freeze.
Background: Integrin alpha 3/CD49c
Alternate Names
CD49c, ITGA3
Gene Symbol
ITGA3
Additional Integrin alpha 3/CD49c Products
Product Documents for Integrin alpha 3/CD49c Antibody (158A3) [CoraFluor™ 1]
Product Specific Notices for Integrin alpha 3/CD49c Antibody (158A3) [CoraFluor™ 1]
CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...