IL-17RE Antibody (46N8G7) [DyLight 680]
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-27366FR
Conjugate
Catalog #
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
DyLight 680 (Excitation = 692 nm, Emission = 712 nm)
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 46N8G7
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Applications for IL-17RE Antibody (46N8G7) [DyLight 680]
Application
Recommended Usage
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.
Formulation, Preparation, and Storage
Purification
Protein G purified
Formulation
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C in the dark.
Background: IL-17RE
Long Name
Interleukin 17 Receptor E
Alternate Names
IL-17 RE, IL17RE, Il25r
Gene Symbol
IL17RE
Additional IL-17RE Products
Product Documents for IL-17RE Antibody (46N8G7) [DyLight 680]
Product Specific Notices for IL-17RE Antibody (46N8G7) [DyLight 680]
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...