Skip to main content

Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15362

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-15362-100ul
NBP3-15362-20ul

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7O4Q9 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glutathione Peroxidase 4/GPX4 (P36969). MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) (NBP3-15362) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

Western Blot: Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) [Glutathione Peroxidase 4/GPX4] -

Western Blot: Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) [Glutathione Peroxidase 4/GPX4] - Western blot analysis of lysates from wild type (WT) and Glutathione Peroxidase 4/GPX4 knockdown (KD) U-87 MG cells using [KD Validated] Glutathione Peroxidase 4/GPX4 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit .
Exposure time: 60s.
Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

Immunocytochemistry/ Immunofluorescence: Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) [NBP3-15362] -

Immunocytochemistry/ Immunofluorescence: Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) [NBP3-15362] - Confocal imaging of paraffin-embedded Mouse testis tissue using [KD Validated] Glutathione Peroxidase 4/GPX4 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) [NBP3-15362] -

Analysis of various lysates using [KD Validated] GPX4 Rabbit mAb at 1:2000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.

Applications for Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:200 - 1:800

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutathione Peroxidase 4/GPX4

Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Alternate Names

GPX4, PHGPx, snGPx

Gene Symbol

GPX4

Additional Glutathione Peroxidase 4/GPX4 Products

Product Documents for Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...