Fucosyltransferase 8/FUT8 Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79869
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
0.5 mg/ml
Product Specifications
Immunogen
The immunogen for this antibody is FUT8. Peptide sequence LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Fucosyltransferase 8/FUT8 Antibody - BSA Free
Western Blot: Fucosyltransferase 8/FUT8 Antibody [NBP1-79869]
Western Blot: Fucosyltransferase 8/FUT8 Antibody [NBP1-79869] - Fetal Liver Lysate 1ug/ml Gel Concentration 12%Western Blot: Fucosyltransferase 8/FUT8 Antibody - BSA Free [NBP1-79869] -
The relationship between the expression of FUT8 and E. coli infection was analyzed at the tissue and cell levels. (A) Expression of the FUT8 gene in 12 tissues of 35-day-old Meishan pigs. (B) Differential expression analysis of the FUT8 gene in intestinal tissues between E. coli F18-resistant and -sensitive Meishan piglets. (C) Expression levels of FUT8 in IPEC-J2 cells with E. coli infection were determined by Western blotting. (D) FUT8 expression analysis in IPEC-J2 cells was determined using Western blotting, which was induced by 1 ug/mL LPS at 0 h, 2 h, 4 h, and 6 h. (E) Expression of FUT8 in IPEC-J2 cells with E. coli infection was determined by RT-qPCR testing. (F) FUT8 expression in IPEC-J2 cells with 1 ug/mL LPS at 0 h, 2 h, 4 h, and 6 h induction was determined using RT-qPCR testing. * Represents a significant difference (p < 0.05) and ** represents an extremely significant difference (p < 0.01). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36499043), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Fucosyltransferase 8/FUT8 Antibody - BSA Free [NBP1-79869] -
The relationship between the expression of FUT8 and E. coli infection was analyzed at the tissue and cell levels. (A) Expression of the FUT8 gene in 12 tissues of 35-day-old Meishan pigs. (B) Differential expression analysis of the FUT8 gene in intestinal tissues between E. coli F18-resistant and -sensitive Meishan piglets. (C) Expression levels of FUT8 in IPEC-J2 cells with E. coli infection were determined by Western blotting. (D) FUT8 expression analysis in IPEC-J2 cells was determined using Western blotting, which was induced by 1 ug/mL LPS at 0 h, 2 h, 4 h, and 6 h. (E) Expression of FUT8 in IPEC-J2 cells with E. coli infection was determined by RT-qPCR testing. (F) FUT8 expression in IPEC-J2 cells with 1 ug/mL LPS at 0 h, 2 h, 4 h, and 6 h induction was determined using RT-qPCR testing. * Represents a significant difference (p < 0.05) and ** represents an extremely significant difference (p < 0.01). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36499043), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Fucosyltransferase 8/FUT8 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Fucosyltransferase 8/FUT8
Alternate Names
alpha 1,6 Fucosyltransferase, alpha1-6FucT, FUT8
Gene Symbol
FUT8
UniProt
Additional Fucosyltransferase 8/FUT8 Products
Product Documents for Fucosyltransferase 8/FUT8 Antibody - BSA Free
Product Specific Notices for Fucosyltransferase 8/FUT8 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...