Skip to main content

ERK1/2 Antibody (2Z8O1)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35062

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-35062-100ul
NBP3-35062-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 2Z8O1

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 180-360 of human ERK1/2 (P28482).

Sequence:
HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit ERK1/2 Antibody (2Z8O1) (NBP3-35062) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ERK1/2 Antibody (2Z8O1)

ERK1/2 Antibody (2Z8O1)

Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody (2Z8O1) [NBP3-35062] -

Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody (2Z8O1) [NBP3-35062] - Confocal imaging of HeLa cells using ERK1/2 Rabbit mAb(Red). The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
ERK1/2 Antibody (2Z8O1)

Immunohistochemistry: ERK1/2 Antibody (2Z8O1) [NBP3-35062] -

Immunohistochemistry: ERK1/2 Antibody (2Z8O1) [NBP3-35062] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using ERK1/2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ERK1/2 Antibody (2Z8O1)

Immunohistochemistry: ERK1/2 Antibody (2Z8O1) [NBP3-35062] -

Immunohistochemistry: ERK1/2 Antibody (2Z8O1) [NBP3-35062] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ERK1/2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for ERK1/2 Antibody (2Z8O1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ERK1/2

The extracellular signal-regulated kinases 1 and 2 (ERK1 and ERK2), also called p44 and p42 MAP kinases, are members of the Mitogen Activated Protein Kinase (MAPK) family of proteins found in all eukaryotes. Because the 44 kDa ERK1 and the 42 kDa ERK2 are highly homologous and both function in the same protein kinase cascade, the two proteins are often referred to collectively as ERK1/2 or p44/p42 MAP kinase (1). They are both located in the cytosol and mitochondria (2). While the role of cytosol ERK1/2 is well studied and involved in multiple cellular functions (2), the role of mitochondrial ERK1/2 remains poorly understood. Both ERK 1 and 2 are activated by MEK1 or MEK2, by dual phosphorylation of a threonine and tyrosine residue in the activation loop (TEY motif) (1, 3). Either phosphorylation alone can induce an electrophoretic mobility shift, but both are required for activation of the kinase. This dual phosphorylation is efficiently detected by phosphorylation state-specific antibody directed to the pTEpY motif. Once activated, MAP kinases phosphorylate a broad spectrum of substrates, including cytoskeletal proteins, translation regulators, transcription factors, and the Rsk family of protein kinases (4). ERK1/2 activation is generally thought to confer a survival advantage to cells (5); however there is increasing evidence that suggests that the activation of ERK1/2 also contributes to cell death under certain conditions (5). ERK1/2 also is activated in neuronal and renal epithelial cells upon exposure to oxidative stress and toxicants or deprivation of growth factors, and inhibition of the ERK pathway blocks apoptosis (5).

Alternate Names

EC 2.7.11, ERK-1, ERK1p44-MAPK, ERT2, Extracellular signal-regulated kinase 1, extracellular signal-related kinase 1, HS44KDAP, HUMKER1A, Insulin-stimulated MAP2 kinase, MAP kinase 1, MAP kinase 3, MAP kinase isoform p44, MAPK 1, MAPK 3, MGC20180, Microtubule-associated protein 2 kinase, Mitogen-activated protein kinase 1, mitogen-activated protein kinase 3, p44erk1, p44-ERK1, P44MAPK, PRKM3EC 2.7.11.24

Gene Symbol

MAPK3

Additional ERK1/2 Products

Product Documents for ERK1/2 Antibody (2Z8O1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ERK1/2 Antibody (2Z8O1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...