Skip to main content

Cytokeratin 4 Antibody (6H9R6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15243

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-15243-100ul
NBP3-15243-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6H9R6 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 4 (P19013). MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Cytokeratin 4 Antibody (6H9R6) (NBP3-15243) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Cytokeratin 4 Antibody (6H9R6)

Western Blot: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Western Blot: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Western Blot: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Western blot analysis of extracts of various cell lines, using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Immunofluorescence analysis of mouse large intestine using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry-Paraffin: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry-Paraffin: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Cytokeratin 4 Antibody (6H9R6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytokeratin 4

Keratins are a family of structurally related proteins that form the intermediate filament cytoskeleton in epithelial cells. White sponge nevus (WSN) is a benign autosomal dominant disorder which affects non-cornifying stratified squamous epithelial. Keratins are expressed in pairs by epithelial cells in a tissue and cell specific manner. The major differentiation specific keratins of the buccal mucosa, nasal, esophageal and anogenital epithelia are CK-4 and CK-13. The tissue distribution and nature of the lesions in patients affected by WSN suggested that mutations in CK-4 and/or CK-13 might be responsible for this disorder (1). K4 and K13 form heterodimers in normal epithelial cells. In humans, K4 is present in all layers of the epidermis at 10 weeks and gradually disappears, starting from the basal layers at 15 weeks and becoming totally absent at around 20 weeks. This period corresponds to the early fetal period when melanoblasts derived from the neural crest migrate through the dermis into the basal layer of the epidermis (2)

Alternate Names

CK4, CK-4, CYK4cytokeratin-4, Cytokeratin-4, FLJ31692, K4cytokeratin 4, keratin 4, keratin, type II cytoskeletal 4, Keratin-4, Type-II keratin Kb4

Gene Symbol

KRT4

Additional Cytokeratin 4 Products

Product Documents for Cytokeratin 4 Antibody (6H9R6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cytokeratin 4 Antibody (6H9R6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...