Cystatin B/Stefin B Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85430

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85430
NBP1-85430-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Cystatin B Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Cystatin B/Stefin B Antibody - BSA Free (NBP1-85430) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Cystatin B/Stefin B Antibody - BSA Free

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430]

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430]

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430] - Analysis in human cell lines A-431 and U-251MG using anti-CSTB antibody. Corresponding CSTB RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunocytochemistry/ Immunofluorescence: Cystatin B/Stefin B Antibody [NBP1-85430]

Immunocytochemistry/Immunofluorescence: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430]

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430]

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-557
View 5 more images

Applications for Cystatin B/Stefin B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cystatin B

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1).

Alternate Names

CSTB, Stefin B

Gene Symbol

CSTB

Additional Cystatin B Products

Product Documents for Cystatin B/Stefin B Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Cystatin B/Stefin B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.