Skip to main content

Collagen XIII alpha 1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13854

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13854
NBP2-13854-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Collagen XIII alpha 1 Antibody - BSA Free (NBP2-13854) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Collagen XIII alpha 1 Antibody - BSA Free

Western Blot: Collagen XIII alpha 1 Antibody [NBP2-13854]

Western Blot: Collagen XIII alpha 1 Antibody [NBP2-13854]

Western Blot: Collagen XIII alpha 1 Antibody [NBP2-13854] - Analysis in human cell lines PC-3 and Caco-2 using anti-COL13A1 antibody. Corresponding COL13A1 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Western Blot: Collagen XIII alpha 1 Antibody [NBP2-13854]

Western Blot: Collagen XIII alpha 1 Antibody [NBP2-13854]

Western Blot: Collagen XIII alpha 1 Antibody [NBP2-13854] - MDA-MB-231 and MDA-MB-231-BrM2 whole cell lysates were loaded with 50 ug/lane. 10% SDS-PAGE. Collagen XIII alpha 1 Antibody (NBP2-13854) was used for primary antibody: 1:250, 4C, overnight. WB image submitted by a verified customer review.
Collagen XIII alpha 1 Antibody

Western Blot: Rabbit Polyclonal Collagen XIII alpha 1 Antibody [NBP2-13854] -

Western Blot: Rabbit Polyclonal Collagen XIII alpha 1 Antibody [NBP2-13854] - MDA-MB-231 whole cell lysate was loaded with 100 ug/lane. 10% SDS-PAGE. Collagen XIII alpha 1 Antibody (NBP2-13854): 1:200, 4C, overnight. Image from a verified customer review.

Applications for Collagen XIII alpha 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml

Reviewed Applications

Read 2 reviews rated 5 using NBP2-13854 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Collagen XIII alpha 1

COL13A1 encodes the alpha chain of one of the nonfibrillar collagens. The function of this gene product is not known, however, it has been detected at low levels in all connective tissue-producing cells so it may serve a general function in connective tissues. Unlike most of the collagens, which are secreted into the extracellular matrix, collagen XIII contains a transmembrane domain and the protein has been localized to the plasma membrane. The transcripts for this gene undergo complex and extensive splicing involving at least eight exons. Like other collagens, collagen XIII is a trimer; it is not known whether this trimer is composed of one or more than one alpha chain isomer. A number of alternatively spliced transcript variants have been described, but the full length nature of some of them has not been determined. Transcript Variant: This variant (1) encodes isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

COL13A1

Gene Symbol

COL13A1

Additional Collagen XIII alpha 1 Products

Product Documents for Collagen XIII alpha 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Collagen XIII alpha 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...