CHST8 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69273

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP1-69273 has been discontinued. View all CHST8 products.

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

View all CHST8 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CHST8(carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8) The peptide sequence was selected from the middle region of CHST8. Peptide sequence GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CHST8 Antibody - BSA Free

Western Blot: CHST8 Antibody [NBP1-69273]

Western Blot: CHST8 Antibody [NBP1-69273]

Western Blot: CHST8 Antibody [NBP1-69273] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: CHST8 Antibody [NBP1-69273]

Western Blot: CHST8 Antibody [NBP1-69273]

Western Blot: CHST8 Antibody [NBP1-69273] - This Anti-CHST8 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.25ug/ml.
Western Blot: CHST8 Antibody [NBP1-69273]

Western Blot: CHST8 Antibody [NBP1-69273]

Western Blot: CHST8 Antibody [NBP1-69273] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
View 1 more images

Applications for CHST8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHST8

Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates.Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates (Hiraoka et al., 2001 [PubMed 11445554]).[supplied by OMIM].

Alternate Names

carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8, carbohydrate sulfotransferase 8, EC 2.8.2.-, GalNAc-4-O-sulfotransferase 1, GalNAc4ST, GALNAC4ST1, GalNAc-4-ST1, galNAc4ST-1, N-acetylgalactosamine-4-O-sulfotransferase 1

Gene Symbol

CHST8

UniProt

Q9H2A9 (Human)

Additional CHST8 Products

Product Documents for CHST8 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CHST8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.