CACNA2D4 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87111

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87111
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all CACNA2D4 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D4. Peptide sequence: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit CACNA2D4 Antibody - BSA Free (NBP2-87111) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CACNA2D4 Antibody - BSA Free

Western Blot: CACNA2D4 Antibody [NBP2-87111]

Western Blot: CACNA2D4 Antibody [NBP2-87111]

Western Blot: CACNA2D4 Antibody [NBP2-87111] - Host: Rabbit. Target Name: CACNA2D4. Sample Type: A549 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for CACNA2D4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CACNA2D4

FUNCTION: The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Defects in CACNA2D4 are the cause of retinal cone dystrophy 4 (RCD4). RCD4 is characterized by minimal symptoms except for slowly progressive reduction in visual acuity.; Tissue specificity: Predominantly expressed in certain types of endocrine cells. Present in the Paneth cells of the small intestine. Also present in the erythroblasts in the fetal liver, in the cells of the zona reticularis of the adrenal gland and in the basophiles of the pituitary. Present at low level in some brain regions such as the cerebellum (at protein level).; Subcellular location: Membrane; Single-pass type I membrane protein; Miscellaneous: In contrast to CACNA2D1 and CACNA2D2, it does not bind gabapentin, an antiepileptic drug.

Long Name

Voltage-dependent calcium channel subunit alpha-2/delta-4

Alternate Names

calcium channel, voltage-dependent, alpha 2/delta subunit 4, RCD4, voltage-dependent calcium channel subunit alpha-2/delta-4, voltage-gated calcium channel alpha(2)delta-4 subunit, Voltage-gated calcium channel subunit alpha-2/delta-4

Gene Symbol

CACNA2D4

Additional CACNA2D4 Products

Product Documents for CACNA2D4 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CACNA2D4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.