Skip to main content

B3GALT1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69327

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-69327

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

Synthetic peptides corresponding to B3GALT1(UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1) The peptide sequence was selected from the N terminal of B3GALT1. Peptide sequence MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for B3GALT1 Antibody - BSA Free

Western Blot: B3GALT1 Antibody [NBP1-69327]

Western Blot: B3GALT1 Antibody [NBP1-69327]

Western Blot: B3GALT1 Antibody [NBP1-69327] - This Anti-B3GALT1 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.
Western Blot: B3GALT1 Antibody [NBP1-69327]

Western Blot: B3GALT1 Antibody [NBP1-69327]

Western Blot: B3GALT1 Antibody [NBP1-69327] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Applications for B3GALT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: B3GalT1

B3GALT1 is a member of the beta-1,3-galactosyltransferase (beta3GalT) family. This family are type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene is expressed exclusively in the brain. The encoded protein shows strict donor substrate specificity for UDP-galactose.This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene is expressed exclusively in the brain. The encoded protein shows strict donor substrate specificity for UDP-galactose.

Long Name

Beta-1,3-Galactosyltransferase 1

Alternate Names

Beta3Gal-T1, Beta3GalT-1, Beta3GalT1

Gene Symbol

B3GALT1

UniProt

Additional B3GalT1 Products

Product Documents for B3GALT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for B3GALT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...