AP4E1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84440

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP2-84440 has been discontinued. View all AP4E1 products.

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all AP4E1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AP4E1. Peptide sequence: CSSFSSLSNVAYEDDYYSNTLHDTGDKELKKFSLTSELLDSESLTELPLV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit AP4E1 Antibody - BSA Free (NBP2-84440) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for AP4E1 Antibody - BSA Free

Western Blot: AP4E1 Antibody [NBP2-84440]

Western Blot: AP4E1 Antibody [NBP2-84440]

Western Blot: AP4E1 Antibody [NBP2-84440] - Host: Rabbit. Target Name: AP4E1. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for AP4E1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AP4E1

AP4E1, also known as AP-4 complex subunit epsilon-1, contains a 127 kDa and a 119 kDa isoform, and is a part of a clathrin- or nonclathrin-coated vesicle, which pursues proteins from the trans-Golgi network as they move towards the endosomal-lysosomal system. Current research is being conducted to determine the relation between AP4E1 and several diseases and disorders, such as paraplegia, neuronitis, intellectual disability, spasticity, malaria, short stature, and cerebriitis. The protein is linked to intracellular protein transport and Golgi associated vesicle biogenesis, through which it interacts with AP4B1, ARF1, AP4M1, AP4S1, and ALB.

Alternate Names

Adapter-related protein complex 4 subunit epsilon-1, adaptor-related protein complex 4, epsilon 1 subunit, adaptor-related protein complex AP-4 epsilon, AP-4 adapter complex subunit epsilon, AP-4 complex subunit epsilon-1, AP-4-EPSILON, DKFZp686L12167, Epsilon subunit of AP-4, Epsilon-adaptin

Gene Symbol

AP4E1

Additional AP4E1 Products

Product Documents for AP4E1 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AP4E1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved.