AMSH/STAMBP Antibody (5S2I1)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-33217
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Concentration
Product Specifications
Immunogen
Sequence:
FPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDL
Clonality
Host
Isotype
Theoretical MW
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Scientific Data Images for AMSH/STAMBP Antibody (5S2I1)
Western Blot: AMSH/STAMBP Antibody (5S2I1) [NBP3-33217] -
Western Blot: AMSH/STAMBP Antibody (5S2I1) [NBP3-33217] - Western blot analysis of various lysates using AMSH/STAMBP Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Applications for AMSH/STAMBP Antibody (5S2I1)
ELISA
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Preservative
Concentration
Shipping
Stability & Storage
Background: AMSH/STAMBP
Associated Molecule with the SH3 Domain of STAM (AMSH), also known as STAM Binding Protein (STAMBP), is a 424 amino acid (aa) zinc metalloprotease member of the peptidase M67C class of enzymes with a predicted molecular weight of 50 kDa. The mouse and rat AMSH/STAMBP orthologs share 83% and 84% aa sequence identity with the human protein, respectively. AMSH/STAMBP is ubiquitously expressed and functions at endosomes where it opposes Ubiquitin-dependent sorting and recycling of receptors to lysosomes. The ability of AMSH/STAMBP to cleave K63-linked, but not K48-linked, poly-Ubiquitin chains is mediated by a JAMM motif (aa 335-348). Receptor substrates for AMSH/STAMBP include EGF R and Erb2. AMSH/STAMBP also functions in cytokine signaling and participates in cMyc induction by IL-2 or GM-CSF, as well as bone morphogenic protein (BMP) signaling via inhibition of Smad proteins. AMSH/STAMBP knockout mice show early-onset neurodegeneration and increased protein deposits in the brain, suggesting that AMSH/STAMBP may contribute to neurodegenerative diseases such as Alzheimer’s Disease, ALS, or Parkinson’s Disease.
Long Name
Alternate Names
Gene Symbol
Additional AMSH/STAMBP Products
Product Documents for AMSH/STAMBP Antibody (5S2I1)
Product Specific Notices for AMSH/STAMBP Antibody (5S2I1)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.