Skip to main content

Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16373

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16373-100ul
NBP3-16373-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10Q2X7 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Alkaline Phosphatase/ALPP/ALPI (P05187). ALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) (NBP3-16373) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7)

Western Blot: Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) [NBP3-16373]

Western Blot: Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) [NBP3-16373]

Western Blot: Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) [NBP3-16373] - Western blot analysis of extracts of PC-3 cells, using Alkaline Phosphatase/ALPP/ALPI Rabbit mAb (NBP3-16373) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) [NBP3-16373]

Western Blot: Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) [NBP3-16373]

Western Blot: Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) [NBP3-16373] - Western blot analysis of extracts of Mouse testis, using Alkaline Phosphatase/ALPP/ALPI Rabbit mAb (NBP3-16373) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7)

Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) [NBP3-16373] - Human placenta using Placental alkaline phosphatase (PLAP) antibody at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7) [NBP3-16373] - Human placenta using Placental alkaline phosphatase (PLAP) antibody at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunohistochemistry

1:1000 - 1:4000

Immunohistochemistry-Paraffin

1:1000 - 1:4000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Alkaline Phosphatase/ALPP/ALPI

The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells.

Alternate Names

Alkaline phosphatase Regan isozyme, alkaline phosphatase, placental type, alkaline phosphomonoesterase, ALP, ALPI, EC 3.1.3.1, glycerophosphatase, IAP, Intestinal alkaline phosphatase, intestinal-type alkaline phosphatase, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1

Gene Symbol

ALPP

Additional Alkaline Phosphatase/ALPP/ALPI Products

Product Documents for Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Alkaline Phosphatase/ALPP/ALPI Antibody (10Q2X7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...