Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16288
Recombinant Monoclonal Antibody
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7T10F5 expressed in HEK293
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Aldo-keto Reductase 1C3/AKR1C3 (P42330). SKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) (NBP3-16288) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)
Western Blot: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288]
Western Blot: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] - Western blot analysis of extracts of various cell lines, using Aldo-keto Reductase 1C3/AKR1C3 Rabbit mAb (NBP3-16288) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunocytochemistry/Immunofluorescence: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] -
Immunocytochemistry/Immunofluorescence: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] - Confocal imaging of A549 cells using AKR1C3 Rabbit mAb (dilution 1:100) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] -
Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] - Confocal imaging of A549 cells using Aldo-keto Reductase 1C3/AKR1C3 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.Applications for Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Aldo-keto Reductase 1C3/AKR1C3
Long Name
Aldo-keto Reductase Family 1, Member C3
Alternate Names
AKR1C3, AldoketoReductase 1C3, DD3, DDX, HA1753, HAKRB, HSD17B5, PGFS
Gene Symbol
AKR1C3
Additional Aldo-keto Reductase 1C3/AKR1C3 Products
Product Documents for Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)
Product Specific Notices for Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...