Skip to main content

Adenosine A1R Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15570

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-15570-100ul
NBP3-15570-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 250-326 of human Adenosine A1R (NP_000665.1). LHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Adenosine A1R Antibody - Azide and BSA Free (NBP3-15570) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Adenosine A1R Antibody - Azide and BSA Free

Western Blot: Adenosine A1R AntibodyAzide and BSA Free [NBP3-15570]

Western Blot: Adenosine A1R AntibodyAzide and BSA Free [NBP3-15570]

Western Blot: Adenosine A1R Antibody [NBP3-15570] - Western blot analysis of extracts of Mouse heart, using Adenosine A1R antibody (NBP3-15570) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.
Immunohistochemistry-Paraffin: Adenosine A1R Antibody - Azide and BSA Free [NBP3-15570]

Immunohistochemistry-Paraffin: Adenosine A1R Antibody - Azide and BSA Free [NBP3-15570]

Immunohistochemistry-Paraffin: Adenosine A1R Antibody [NBP3-15570] - Immunohistochemistry of paraffin-embedded human esophageal using Adenosine A1R Rabbit pAb (NBP3-15570) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Adenosine A1R Antibody - Azide and BSA Free [NBP3-15570]

Immunohistochemistry-Paraffin: Adenosine A1R Antibody - Azide and BSA Free [NBP3-15570]

Immunohistochemistry-Paraffin: Adenosine A1R Antibody [NBP3-15570] - Immunohistochemistry of paraffin-embedded rat brain using Adenosine A1R Rabbit pAb (NBP3-15570) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for Adenosine A1R Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Adenosine A1R

Adenosine receptors (ARs) are members of the 7-transmembrane domain G-protein-coupled receptor superfamily. Structural, biochemical and pharmacological analyses of the AR genes and protein has led to the discovery of four distinct AR subtypes (A1, A2a, A2b, A3). Activation of ARs mediates several receptor subtype-specific physiological processes that include cardiac rate, smooth muscle tone, platelet aggregation, inflammation, cell growth and death, and neurotransmission.The A1AR is a glycoprotein that can activate Gi and Go proteins in vitro. In intact cells, agonist occupation of the A1AR has been shown to cause pertussis toxin-sensitive inhibition of adenylyl cyclase activity and, in some systems, a stimulation of phospholipase C resulting in mobilization of intracellular calcium stores. Activation of potassium channels by A1AR has been intensively studied in relation to its dramatic effects on the cardiovascular system. A1AR protein is highly expressed in brain (especially cerebellum, hippocampus, thalamus, and cortex) and spinal cord and in part, modulates neurotransmitter release. In white adipocytes A1AR inhibits lipolysis and stimulates glucose uptake. Other tissues also express A1AR including kidney and testis.

Long Name

Adenosine A1 Receptor

Alternate Names

Adenosine A1 R, ADORA1, RDC7

Gene Symbol

ADORA1

Additional Adenosine A1R Products

Product Documents for Adenosine A1R Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Adenosine A1R Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov