5-Lipoxygenase Antibody (5C5Z2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16150

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16150-100ul
NBP3-16150-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5C5Z2 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all 5-Lipoxygenase Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 5-Lipoxygenase (P09917). CYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit 5-Lipoxygenase Antibody (5C5Z2) (NBP3-16150) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for 5-Lipoxygenase Antibody (5C5Z2)

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Western blot analysis of extracts of Raji cells, using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Immunohistochemistry of paraffin-embedded mouse spleen using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Western blot analysis of extracts of Rat lung, using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
View 2 more images

Applications for 5-Lipoxygenase Antibody (5C5Z2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:100 - 1:400

Immunohistochemistry

1:100 - 1:1000

Immunohistochemistry-Paraffin

1:100 - 1:1000

Western Blot

1:1000 - 1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 5-Lipoxygenase

5 Lipoxygenase encodes a protein which, with Arachidonate 5-lipoxygenase-activating protein, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation.

Alternate Names

5Lipoxygenase, 5LPG, ALOX5, LOG5, LOX5A

Gene Symbol

ALOX5

Additional 5-Lipoxygenase Products

Product Documents for 5-Lipoxygenase Antibody (5C5Z2)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for 5-Lipoxygenase Antibody (5C5Z2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.