14-3-3 gamma Antibody (5R4Q4)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16771
Recombinant Monoclonal Antibody
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA
Label
Unconjugated
Antibody Source
Monoclonal Rabbit IgG Clone # 5R4Q4
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981). VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit 14-3-3 gamma Antibody (5R4Q4) (NBP3-16771) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for 14-3-3 gamma Antibody (5R4Q4)
Western Blot: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771]
Western Blot: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771] - Western blot analysis of extracts of various cell lines, using 14-3-3 gamma Rabbit mAb (NBP3-16771) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Immunohistochemistry-Paraffin: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771]
Immunohistochemistry-Paraffin: 14-3-3 gamma Antibody (5R4Q4) [NBP3-16771] - Immunohistochemistry of paraffin-embedded mouse brain using 14-3-3 gamma Rabbit mAb (NBP3-16771) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.Applications for 14-3-3 gamma Antibody (5R4Q4)
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: 14-3-3 gamma
Signal-induced phosphorylation has the ability to change protein function, however phosphorylation is not always enough to change a protein's function. 14-3-3 gamma has the ability to bind a large number of target proteins thereby affecting the proteins' activity and/or function.
14-3-3 gamma is highly expressed in brain, heart and skeletal muscle, where it is induced by growth factors in human vascular smooth muscle cells. This suggests that 14-3-3 gamma may play a role in muscle tissue function.
Alternate Names
1433 gamma, YWHAG
Gene Symbol
YWHAG
Additional 14-3-3 gamma Products
Product Documents for 14-3-3 gamma Antibody (5R4Q4)
Product Specific Notices for 14-3-3 gamma Antibody (5R4Q4)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...