AGFG2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25269PEP

Catalog #
Availability
Size / Price
Qty
NBP3-25269PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

View all AGFG2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGFG2

Source: E.coli

Amino Acid Sequence: MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25269It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-25269PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AGFG2

AGFG2 codes for a protein is 481 amino acids long and weighs approximately 49 kDa, with a short isoform with a length of 156 amino acids and a weight of approximately 17 kDa. AGFG2 codes for a protein that helps control the necleocytoplasmic transfer of proteins and RNAs, which is a process known as the Rev export pathway. Current studies are being done on several diseases and disorders relating to this gene, including xerophthalmia and bronchiectasis. AGFG2 has also been shown to have interactions with EPS15L1, EPS15, and ITSN1.

Alternate Names

ArfGAP with FG repeats 2, HIV-1 Rev binding protein-like, HIV-1 Rev-binding protein-like protein, HRBLnucleoporin, RAB-R, RABRarf-GAP domain and FG repeats-containing protein 2, Rev/Rex activation domain binding protein-related, Rev/Rex activation domain-binding protein related

Gene Symbol

AGFG2

Additional AGFG2 Products

Product Documents for AGFG2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AGFG2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy Policy
Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved. All trademarks and registered trademarks are the property of Bio-Techne and its brands unless otherwise specified.